PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA23457
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 300aa    MW: 33380.6 Da    PI: 6.7891
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA23457genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.7e-30109162155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Tp57577_TGAC_v2_mRNA23457 109 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 162
                                59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.78E-20106166IPR009057Homeodomain-like
PROSITE profilePS5129411.059106165IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-30108167IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-24110162IPR006447Myb domain, plants
PfamPF002491.1E-7112161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MREDDSNWFS RWEEQLPSPE ELMPLSQTLI TPDLAIAFDI RNNINNNNNN PLNNINHSNP  60
QQQQQHHQNH QNQQQQPQPS SLPSSTDFAD SGELGSGTAG EEPARTLKRP RLVWTPQLHK  120
RFVDAVAHLG IKNAVPKTIM QLMSVDGLTR ENVASHLQKY RLYLKRMQGI SSGGGGGSGG  180
GSGGGNDPAT DXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXGC CCCCCSQQHQ  240
QQHQNQHQNQ HQNQHQQQQL HRIGTQIHHS PVGGYVEDME SANASGGRKV LTLFPTGDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-21108167463ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171181SGGGGGSGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6921424e-42EF692142.1 Trifolium repens clone CloverSSR-62_H04_009_1 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162050.19e-95hypothetical protein PHAVU_001G119500g
SwissprotQ9SNB49e-46PCL1_ARATH; Transcription factor LUX
TrEMBLV7CV769e-95V7CV76_PHAVU; Uncharacterized protein
STRINGGLYMA19G30700.19e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.12e-58G2-like family protein